SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088RQI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088RQI3
Domain Number 1 Region: 44-80
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000288
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A088RQI3
Sequence length 90
Comment (tr|A0A088RQI3|A0A088RQI3_9TRYP) Uncharacterized protein {ECO:0000313|EMBL:AIN97499.1} KW=Complete proteome OX=5679 OS=Leishmania panamensis. GN=LPMP_200070 OC=Leishmaniinae; Leishmania; Leishmania guyanensis species complex.
Sequence
MADHATAALMAEPTLKEAAAAVFNEEECTALKANLRAEQIAQAKYLRAHPEIHKAVQEGL
ARVLQSQPEDPVTFLTQYFLSEEFLHQRQP
Download sequence
Identical sequences A0A088RQI3 A0A1E1ITV6 A4HAE4
gi|154336157|ref|XP_001564314.1| psu|LbrM20_V2.0270 XP_001564314.1.15230 XP_010698206.1.42505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]