SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088RZI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088RZI7
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.57e-30
Family Nip7p homolog, N-terminal domain 0.00018
Further Details:      
 
Domain Number 2 Region: 97-171
Classification Level Classification E-value
Superfamily PUA domain-like 4.03e-21
Family PUA domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A088RZI7
Sequence length 181
Comment (tr|A0A088RZI7|A0A088RZI7_9TRYP) 60S ribosome subunit biogenesis protein NIP7 homolog {ECO:0000256|PIRNR:PIRNR017190} KW=Complete proteome OX=5679 OS=Leishmania panamensis. GN=LPMP_331420 OC=Leishmaniinae; Leishmania; Leishmania guyanensis species complex.
Sequence
MRSLTDEETKKLFDKLAQYIGANTTHLLERKGEEEHVFRLHKNRIWYMPLRLAKLASCVS
KTNLMGIGVLFAKVTHNGNVRIQVTALEYIAQYSLFKIWVKPNQEQRFLYGGNVSRAGLG
RITESTPKYQKVAVFSMGDIPLGFGVAAQSTLECRKCEMNTQVLFHEADVGEYLRDEARM
T
Download sequence
Identical sequences A0A088RZI7 A4HLJ6
gi|154343972|ref|XP_001567930.1| psu|LbrM33_V2.1620 XP_001567930.1.15230 XP_010702234.1.42505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]