SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088UDQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088UDQ8
Domain Number 1 Region: 11-155
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000824
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A088UDQ8
Sequence length 167
Comment (tr|A0A088UDQ8|A0A088UDQ8_9BURK) SMI1 / KNR4 family protein {ECO:0000313|EMBL:AIO35398.1} KW=Complete proteome OX=95486 OS=Burkholderia cenocepacia. GN=DM39_4671 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MSKLKLVKLAKSLTEDDISNFEIQFGIRMPDELRKHYLKENGGFPDCFKMCYIPKRVDPC
DANGVTFNGFYPIKYPSTADGSTLEENYIDYTDTQTLFDKDEYIPFAFDVSGFPHLMKFD
DHAIYLLNRDVVDEDGHEVIEFVAPSLQEFIDGLISGDEFEDLISDC
Download sequence
Identical sequences A0A088UDQ8
WP_040130508.1.82257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]