SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088UGP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088UGP6
Domain Number 1 Region: 3-66
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000732
Family Trp repressor, TrpR 0.064
Further Details:      
 
Domain Number 2 Region: 64-107
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000337
Family Transcription factor IIB (TFIIB), core domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A088UGP6
Sequence length 171
Comment (tr|A0A088UGP6|A0A088UGP6_9BURK) Transposase family protein {ECO:0000313|EMBL:AIO36448.1} KW=Complete proteome OX=95486 OS=Burkholderia cenocepacia. GN=DM39_6181 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MNTHQNSRLAFGRRLEMVQEITEFDSSVQQAAADHGVTAPTVRKWLGRYLVGGAPALADA
SSRPARSPRSIAAATALLIVELRQQRLLQRQIARQAGVSASTVSRVLARAGLSRLSDLQP
REPVQRYEYEAPGDLLHIDIKKLGRIARPGHRVTGNRRDTADGGEGQACRR
Download sequence
Identical sequences A0A088UGP6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]