SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088X5W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088X5W1
Domain Number 1 Region: 11-190
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 9.81e-30
Family MoeA N-terminal region -like 0.00028
Further Details:      
 
Domain Number 2 Region: 525-668
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.89e-16
Family SMI1/KNR4-like 0.013
Further Details:      
 
Domain Number 3 Region: 389-462
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 0.0000000017
Family MoeA C-terminal domain-like 0.012
Further Details:      
 
Domain Number 4 Region: 193-291,333-375
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 0.00000224
Family MogA-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A088X5W1
Sequence length 672
Comment (tr|A0A088X5W1|A0A088X5W1_9BURK) Uncharacterized protein {ECO:0000313|EMBL:AIO69013.1} KW=Complete proteome OX=342113 OS=Burkholderia oklahomensis. GN=DM82_5762 OC=Burkholderiaceae; Burkholderia; pseudomallei group.
Sequence
MSEHANFPAWLDQAYDQCRWAVPGAIQSETVLIEDALLRVAAIDVIAPDDVPPVALAASE
GYALRAADTADASGRNPVELDVGSTLRMLTSRAGSPAARAIGAHQAAETPAYFPLPENAD
AIAPRSGHQIAYRDDRPCLRLQGPLSAGHHVIMPGSECRKGDVLLPKGERITVGRQAMLI
AAGVREIVVAKRPRVGVVIAGYDQVPPSDVREPWQRPDTSGPYIRATLRRWGYDVPPVEY
LTPPDMTRPSIDVQQDEYAFKVKLVELAQRYDLIVGAGLPAVPPFRNRGLNAQMMYSTER
TLVEIKQTPAGRFNFGRSDDRSPPKRTTVTLTRPDGTPRGTQALTSYDQATLINLPGHTS
AVAMLMHAIMPRVLDLLEHVAMPGPNWETGVIAHDVERNAERHEMHWGNLCRGANGAPLV
RLLPFQGDGPIRGVAHADVLVAIPAGDGPLFTGSAVQFLRLDRVGPDAPPVDTPPVAAGT
ASQPLQAAAAAAVSSPLAANGDLRNTWKQLDDWFAADPARLPGGLNGPASADAIAALQAA
LGVTLPTEFVESLRIHDGQAEPDAVFADSDALLGAREIVAQWSIWKNLVAGGDFDDMTSE
PDPGIKDDWYNLKWIPFTHDGSGNHLCLDLDPAEGGVVGQVIRVWHDDSVRERVARSFAE
WLAGVADERGAR
Download sequence
Identical sequences A0A088X5W1 A0A1B4A8Y9
WP_010109746.1.20337 WP_010109746.1.24885 WP_010109746.1.51933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]