SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089I608 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089I608
Domain Number 1 Region: 9-95
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00000092
Family Crystallins/Ca-binding development proteins 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A089I608
Sequence length 123
Comment (tr|A0A089I608|A0A089I608_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AIQ18043.1} KW=Complete proteome; Reference proteome OX=1536774 OS=Paenibacillus sp. FSL H7-0357. GN=H70357_16175 OC=Paenibacillus.
Sequence
MKRAVHISQTYPRLTVYSEENYRGRSRIYTGNLGIRNTDNILDGIESLRFFSTSSNATLV
LFSRTRFRGIFRVLRGNHNIRDLDDYINGNDVESIISTNQRLTLAQIRNIRDSGELPAGY
RLI
Download sequence
Identical sequences A0A089I608
WP_038591143.1.33837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]