SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089I7B2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089I7B2
Domain Number 1 Region: 23-171
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.24e-17
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A089I7B2
Sequence length 173
Comment (tr|A0A089I7B2|A0A089I7B2_9BACL) Molybdenum cofactor biosysnthesis protein MoeA {ECO:0000313|EMBL:AIQ18483.1} KW=Complete proteome; Reference proteome OX=1536774 OS=Paenibacillus sp. FSL H7-0357. GN=H70357_18590 OC=Paenibacillus.
Sequence
MTEKAETLWQRIIAKGSRNTPGYEANLNLQPGASVEELDGLASTLEVVLPQELRDFYSIY
NGQDWEAGSQCFVRNLTLSPLEQILEDWEFLNEEFDPDDMEPEIAPQIKPLLWNPRWIPI
ASNGGGDHLCIDTDPTAEGTFGQLLYFYHDWGNRSVEAAGLFDFIEQCLSEEE
Download sequence
Identical sequences A0A089I7B2
WP_038592270.1.33837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]