SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089ICI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089ICI4
Domain Number 1 Region: 30-88,138-197
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000732
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A089ICI4
Sequence length 444
Comment (tr|A0A089ICI4|A0A089ICI4_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AIQ21132.1} KW=Complete proteome; Reference proteome OX=1536774 OS=Paenibacillus sp. FSL H7-0357. GN=H70357_33960 OC=Paenibacillus.
Sequence
MWFGKKETQLDRIKNKLNQAMRKDTAFSEFGSSSHQYRVNGKLTAKELADWQAHNQVTLP
EPFAQFLTKVGNGGAGPYYGIYSIEKAASYTERQALLAEAVLHPGMTKEEWNHLTEPLTN
DEDIPDEEYDDARNKVLGGMLCIGTQGCEYDMYLVLEGKHRGRIVYTSDFHPDHPFFFVY
EDNFLDWYERWLDEIILDYDNGWFGSRMPGDENALIQIYQSAPTEEIQAKALDGMFKFKK
TSQPTLGFLKNIAEQSPKNRTTAIWLICKTSFDAGRKYLLELLQSDRHEGFLQALEILHA
SSKTVDLTEFIPVILQRFDRIHDPETLRYAGYILEDYGAITLLNFAPFLCHADPKMQTTA
IYAARSCENKQGSWQIIEQMLMGGGRQVLNNSILYWGIIPHEKLLPYYKAVWPEYKSNPN
FREKFIGCLRELYLPDDYFDKDEL
Download sequence
Identical sequences A0A089ICI4
WP_038597853.1.33837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]