SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089IF79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089IF79
Domain Number 1 Region: 156-308
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.89e-29
Family SMI1/KNR4-like 0.009
Further Details:      
 
Domain Number 2 Region: 31-114
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000136
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A089IF79
Sequence length 442
Comment (tr|A0A089IF79|A0A089IF79_9BACL) Glucan biosynthesis protein {ECO:0000313|EMBL:AIQ21203.1} KW=Complete proteome; Reference proteome OX=1536774 OS=Paenibacillus sp. FSL H7-0357. GN=H70357_34355 OC=Paenibacillus.
Sequence
MDNHWMNQLTLWHEADEYQQIVDSIMEVPAQERDYAVIGHLARALNNLERYEEALEQLLA
IAGQGANDPLWHFRAGYSYYYLKQYEEAARAFKKADELDPGDQDTLMLLNWSVRGAEKQK
REQKRFAAAQMAKEQSGDSSFFEPADFSDFWENSDYALKEYVSEPPTEEMIASVEQELGY
KLPASYIELMKLQNGGIPQNTCFPTGEATSWAEDHIAISSIMGIGREKSYSLCGDLGSRF
MIEEWGYPDIGVVICDCPSAGHDVVMLDYRLCGREGEPAVIHVDQEGDYEITFLAGSFEA
FIRGLVNDEEYDYDVSEDDGDEGLTQEAIEEGDQLKPFILVEQDNGGMSVILNAGSYKAE
LFQTREDEGFEGSGYDWASLASVFLEEKMPELADSIHFDPEADMFCAYSSNREAVQSFAA
GFKAACEDDALIRDLFSRAELD
Download sequence
Identical sequences A0A089IF79
WP_038597978.1.33837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]