SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089IM63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089IM63
Domain Number 1 Region: 12-140
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.94e-31
Family VanY-like 0.0000707
Further Details:      
 
Domain Number 2 Region: 199-225
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.00000641
Family Copper amine oxidase, domain N 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A089IM63
Sequence length 228
Comment (tr|A0A089IM63|A0A089IM63_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AIQ25451.1} KW=Complete proteome; Reference proteome OX=1536775 OS=Paenibacillus sp. FSL H7-0737. GN=H70737_22840 OC=Paenibacillus.
Sequence
MLTLDQVRDKSAARLVGLHPVLAAGAKALIQQSYARGVPIVITQGLRSIAEQNALYAQGR
SKPGPIVTNAKGGTSYHNYGLAFDFALLLPDGNSISWDMNRDGDKDKIADWQEVVQVGKQ
LGLEWGGDWTSFKDYSHLQMAFGLTTTQLRAGKRPTTDQVNEALKRITGEDDQVNKDVKV
TITLNGTKLTDGVLDTGVTYVPVRALAEALGAKVTYDAASKTVNVVKE
Download sequence
Identical sequences A0A089IM63
WP_042190775.1.21252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]