SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089IN39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089IN39
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.19e-27
Family SMI1/KNR4-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A089IN39
Sequence length 152
Comment (tr|A0A089IN39|A0A089IN39_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AIQ24615.1} KW=Complete proteome; Reference proteome OX=1536775 OS=Paenibacillus sp. FSL H7-0737. GN=H70737_18260 OC=Paenibacillus.
Sequence
MYERLAEKLKTTSALKWFPGHGAEESWIAEAEEELGFCLPPSYRWWLVHYGNARLGDGNI
LAIAAPEHREYYDGDLLYIHRLNKAEEWWVGRFPHRLDLFVPDSDELYFFDTSTRDKQGE
FPIMCYDLMNDLIDKYASTFAEFLERLIDERS
Download sequence
Identical sequences A0A089IN39 A0A1R0ZB10
WP_042189330.1.21252 WP_042189330.1.77920 WP_042189330.1.82363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]