SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089JY79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089JY79
Domain Number 1 Region: 156-306
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.96e-29
Family SMI1/KNR4-like 0.012
Further Details:      
 
Domain Number 2 Region: 33-122
Classification Level Classification E-value
Superfamily TPR-like 5.15e-16
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A089JY79
Sequence length 570
Comment (tr|A0A089JY79|A0A089JY79_9BACL) Glucan biosynthesis protein {ECO:0000313|EMBL:AIQ25809.1} KW=Complete proteome; Reference proteome OX=1536775 OS=Paenibacillus sp. FSL H7-0737. GN=H70737_24910 OC=Paenibacillus.
Sequence
MDKELTAQLTQWHEDDEHQKIVDTLMEIPPADRDYEVVSSLARAYNNLGRYEEALEHFAM
IAEQGQNDYLWHFRVGYSYYYLNRYEEAVRVLSIAHDLDPNDENTAMFLKFSQRKLRKEQ
HAAARQAIREQHNDSGTTATPFEGMDLSEFWKDSDYALKEYVSAPPTDELIASVEEELGY
KLPASYISLMKQHNGGVPYNTCFPTEDATSWAEDHIAITGIMGIGREKSYSLCGDLGSPF
MIEEWGYPDIGVVICDCPSAGHDVVMLDYRNCGRDGEPEVIHVDQEDNYEITFLAQDFET
FIRGLVSDEDYDTSEEDKEEDLRKVAVGQFSPLLAKLCSHVSEVDQLEQKIRRVCTRIVE
EKGHFSFHADELSTLMYDLQFWLYTSSYPNTSRQQYLDVYEEMIAFGGEFGQGGYAPGWI
SDWLDGRIREGLIVQKNGVLCFTDQARSEVIARLEAESAEEDVAPFILVDQQGGGMSVIL
NVGSYRSEVFEARADEGFEGNGYDWASLAAVFVNEYMPEWVDTIHFDPEADMFCAYSENS
EAIKQFAVRFKQACEDETLIRDLFSRAELD
Download sequence
Identical sequences A0A089JY79
WP_042191401.1.21252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]