SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089KNM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089KNM5
Domain Number 1 Region: 72-173
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000301
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A089KNM5
Sequence length 185
Comment (tr|A0A089KNM5|A0A089KNM5_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AIQ50771.1} KW=Complete proteome; Reference proteome OX=1536773 OS=Paenibacillus sp. FSL R7-0331. GN=R70331_04010 OC=Paenibacillus.
Sequence
MIWSNTFSSSYQQQPGISAADLGSFTAGWHQRLTESERQEIVSRQRNPFPAAHPLHAQYT
PFDPGLWSIPQMPVPASYLDFLRYSDGGEFGNGDRYFQFFSAGELRAMMLAYEFPEYMPG
AVPFAMDGSGNHYIWDMRSPANSEGEYPILVSHSGSLGYEDSIVIAGSFLELCSGTSAVD
DELNG
Download sequence
Identical sequences A0A089KNM5
WP_081947457.1.69505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]