SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089KYV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089KYV3
Domain Number 1 Region: 18-181
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000602
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A089KYV3
Sequence length 221
Comment (tr|A0A089KYV3|A0A089KYV3_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AIQ54356.1} KW=Complete proteome; Reference proteome OX=1536773 OS=Paenibacillus sp. FSL R7-0331. GN=R70331_24380 OC=Paenibacillus.
Sequence
MNQTQTWEHNLRTFLNAIEAIGGEAEGCSLKPPVRLSEVKKVEEHLGIPLPESLVKVATG
FCGGMELSWSLPDDEELELPLPVELKGIFAGDFIWSIKDIIAAEEERRGWEQQVFSDLDD
EYDRVWHNKLGFMAVGNGDFVAFDLSVPADPPIVYLSHDGGNGHGYILGHNFTDFMDKWS
KIGCVGCEDWQLIPFMDSPVSGIMPDSDNAKLWRSWLKVEL
Download sequence
Identical sequences A0A089KYV3
WP_042179696.1.69505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]