SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089LU09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089LU09
Domain Number 1 Region: 17-127
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.00002
Family HEPN domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A089LU09
Sequence length 153
Comment (tr|A0A089LU09|A0A089LU09_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AIQ63610.1} KW=Complete proteome; Reference proteome OX=169760 OS=Paenibacillus stellifer. GN=PSTEL_11465 OC=Paenibacillus.
Sequence
MGINMNPLDQETFEDNYRAALSYHSRAEQFKSQDQRYSLVFNVACVALERYLVAMCYLYD
APPLNHNYICLMNAAETVVSFPAELSKEIRSLDFIFGICSLDDYFHGTPEPQDADRVLGM
CEAVRDLFDPVTVAEALAESAKLHAKDSQREVG
Download sequence
Identical sequences A0A089LU09
WP_038695273.1.74861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]