SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089M2V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089M2V9
Domain Number 1 Region: 12-157
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000562
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A089M2V9
Sequence length 431
Comment (tr|A0A089M2V9|A0A089M2V9_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AIQ68101.1} KW=Complete proteome OX=189425 OS=Paenibacillus graminis. GN=PGRAT_11065 OC=Paenibacillus.
Sequence
MKEQMNVWKRQWQELIQALGQKGANTRFNVGPPAAESRLAGVEARLGIRLPLELRSLLKE
GAGKAYVYWNLPDAAILPFEVSGELGWDADQLDFFVTPDEEDSGETQRYLSLHPAGNGDE
LLLDLHSASETAVVHWAHETAEYLLLAPKITDFIGKVTALGCVGAEEWQYPEFCGEAGLD
PEKPASRQWMAWLNEYLTLTLAQAQKELSLLLRYAEMFGMDQETAEAFGRYDADEVLQAF
LDRAGQERDSHNKEAILCLAGDVLKEKAADLVRSIWAETLPLEVSRSTLAYLSAHCLPED
EGLERVFRLLEQLAATQKLSGYQANSLLQDFHSRRVLGWMEDKIAFPYDGWDTLYVHSQP
TPSDIVMWLGGSDVQRQIVIAAFPVLYSNTGAEVFSPAELQQIRCLLEQALDEAVLKKEK
QAVRDALGLLA
Download sequence
Identical sequences A0A089M2V9
WP_025703476.1.54186 WP_025703476.1.61298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]