SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089MUB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089MUB7
Domain Number 1 Region: 72-176
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000131
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A089MUB7
Sequence length 185
Comment (tr|A0A089MUB7|A0A089MUB7_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AIQ60054.1} KW=Complete proteome OX=160799 OS=Paenibacillus borealis. GN=PBOR_26215 OC=Paenibacillus.
Sequence
MNAESLFEICYQKHPGASEPELTRFTEEWRKPLTHEEITEITGRQRNPFPVNDPLHAVYR
PFDPALWTLPDMPLPAAYLNFLRYSNGGEFGTAERYVQLFGTDQLRSMMLAYEFPEYMPG
GVPFAMDGSGHHYIWDMRTARDDGAYPILIAHSGNLGYEDAAWIAGSFQELCRGTVSAED
VLYNS
Download sequence
Identical sequences A0A089MUB7
WP_042216436.1.1874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]