SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089N5K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089N5K9
Domain Number 1 Region: 8-102
Classification Level Classification E-value
Superfamily PX domain 2.49e-25
Family PX domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A089N5K9
Sequence length 189
Comment (tr|A0A089N5K9|A0A089N5K9_9TELE) SH3 and PX domain-containing 3-like protein {ECO:0000313|EMBL:AIQ81520.1} OX=1548451 OS=Nothobranchius taeniopygus (striped nothobranch). GN=Sh3px3 OC=Nothobranchius.
Sequence
EDPTKQTKFKGIKTYISYRVTPSHTGHPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQA
TGRFEEDFIEKRKRRLVLWMNHMTSHPVLSQYEGFEHFLMCTDDKQWKLGKRRAEKDEMV
GAHFMLTLQVPTEHQDLQDVEERVDNFKSFARKMDDSVMQLTNVASELVRKHLGGFRKEF
QRLGNSFQS
Download sequence
Identical sequences A0A089N411 A0A089N421 A0A089N426 A0A089N5F4 A0A089N5H8 A0A089N5J2 A0A089N5J7 A0A089N5K9 A0A089N7X3 A0A089N9Q0 A0A089PIC7 A0A089PIG8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]