SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089QFF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089QFF8
Domain Number 1 Region: 36-119
Classification Level Classification E-value
Superfamily TrpR-like 1.46e-18
Family SPO1678-like 0.023
Further Details:      
 
Domain Number 2 Region: 1-53
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000394
Family Cgl2762-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A089QFF8
Sequence length 172
Comment (tr|A0A089QFF8|A0A089QFF8_9LACO) Transposase {ECO:0000313|EMBL:AIR11475.1} KW=Complete proteome OX=1624 OS=Lactobacillus salivarius. GN=LSJ_2059c OC=Lactobacillus.
Sequence
MTKYTQKFELDLIQEYLDTGCSQRCLENKYSLPKDTLKKWWTVYNLKGPEGVKLRHFKRK
FTINFKLRVINYYLNNDVSMSKVAASHNLLCSQISIWLKLFMKGGSEALKPKKKGKPSKM
SKMTKKDTRKILKKESDEIAALKSELRQVKMERDILKKSLTLFGPSKPRRRQ
Download sequence
Identical sequences A0A089QFF8
WP_044005702.1.86350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]