SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089VJS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089VJS9
Domain Number 1 Region: 68-109,172-214
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 5.1e-20
Family HSP40/DnaJ peptide-binding domain 0.0053
Further Details:      
 
Domain Number 2 Region: 88-168
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 4.32e-18
Family DnaJ/Hsp40 cysteine-rich domain 0.00044
Further Details:      
 
Domain Number 3 Region: 1-56
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000000196
Family Chaperone J-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A089VJS9
Sequence length 216
Comment (tr|A0A089VJS9|A0A089VJS9_9STAP) Chaperon protein {ECO:0000313|EMBL:AIR74479.1} OX=246432 OS=Staphylococcus equorum. GN=dnaJ OC=Staphylococcus.
Sequence
EISEAYETLSDENKRANYDQFGHDGPQGGFGGQGFGGQDFSGFGGGGFEDIFSSFFGGGR
QQRDPNAPRKGDDLQYTMTVTFDEAVFGSEKEISIRKDVSCHTCDGAGAKPGTKKKTCQY
CSGAGHVSVEQNTILGRVRTEKVCPVCSGAGQEFEEPCPTCKGKGTENKNVKISVTIPEG
VDNEQQIRLAGEGAPGENGGPQGDLYIVFRVKPSEK
Download sequence
Identical sequences A0A089VJS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]