SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089VN06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089VN06
Domain Number 1 Region: 101-205
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 4.21e-37
Family Neurotrophin 0.00000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A089VN06
Sequence length 205
Comment (tr|A0A089VN06|A0A089VN06_9NEOB) Brain-derived neurotrophic factor {ECO:0000256|RuleBase:RU364086} OX=1240754 OS=Chiasmocleis leucosticta (Santa Catarina humming frog). GN=BDNF OC=Gastrophryninae; Chiasmocleis.
Sequence
GQSGLAYPGLRTHGTLENIGGPIGVSRGGGLPSLTDTFEQVIEELLEEEQSIRQSEENKD
SDMYSSRVMLSTQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISE
WVTATDKKTAVDMAGQTVTVLEKVPVPKGQLKQYFYETKCNPMGYMKEGCRGIDKRYWNS
QCRTTQSYVRALTMDSKKKVGWRFI
Download sequence
Identical sequences A0A089VN06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]