SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089WRJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089WRJ4
Domain Number 1 Region: 31-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000126
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A089WRJ4
Sequence length 166
Comment (tr|A0A089WRJ4|A0A089WRJ4_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:AIR69884.1} KW=Complete proteome OX=1089444 OS=Dickeya solani. GN=LH89_11965 OC=Pectobacteriaceae; Dickeya.
Sequence
MNISNAYDQLNAWINTSNGSYIDIGGERYSFSRLKTISKDELSNFESDNNLKLPNDYKSF
LINVGCVNIFVGEKTAGIEIISPADIRNFSKSVFYNFGDDLYPKLLLTTSIPKFGYFGGF
WMESESKENYGVFYPEIPPELWIEECDFIKFDDWIIKVVEYKSRKI
Download sequence
Identical sequences A0A089WRJ4 A0A0A4AIU0
WP_038663767.1.17782 WP_038663767.1.1785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]