SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089X566 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089X566
Domain Number 1 Region: 20-60,98-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000811
Family SMI1/KNR4-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A089X566
Sequence length 175
Comment (tr|A0A089X566|A0A089X566_STRGA) Uncharacterized protein {ECO:0000313|EMBL:AIR96199.1} KW=Complete proteome; Reference proteome OX=1907 OS=Streptomyces glaucescens. GN=SGLAU_00855 OC=Streptomyces.
Sequence
MWVQRLIELTGWKPLGIPVDWAAVEEELGIPLPADYKELFEAFGGGTFADSVYFLARDEG
VVFDFMSQWRAHLAVDRDPTTGEVSAVDPYSVYAPGGKGLATWAFTEWGDQYCWLIDAQR
PGEYPILARAEDDEWCRYEMSTSEFLYRVLADADFQPFGIAHYNLGATFTPGQEA
Download sequence
Identical sequences A0A089X566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]