SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090BFG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090BFG2
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.1e-23
Family Poly(A) polymerase, PAP, middle domain 0.00023
Further Details:      
 
Domain Number 2 Region: 116-193
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 0.00000000122
Family Poly(A) polymerase, PAP, C-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A090BFG2
Sequence length 296
Comment (tr|A0A090BFG2|A0A090BFG2_HYAAE) RxLR effector candidate protein {ECO:0000313|EMBL:BAP69015.1} OX=559515 OS=(Peronospora arabidopsidis). GN=HaRxLL128 OC=Hyaloperonospora.
Sequence
MFPRASVAALVHRFFSVLVSWQWPTPILVAQPSTGVDANSVEWDPLHNLHDRAHLMPIIT
PGFPAVNTAVNVNLSTLRVLRDEFARGQRILDDLSRCRFSHPAPWNQLFTPTEVLVRYDH
HVAIELRASNEESLAEWSSFVASRTRKLVETLQHTPSVGSLHPLPEIIRPQDPEPSANGE
VVGYYFIGYTVDSPPMPGVRRGNCRLTRERQRMPSTSGNEEWARNCIASATRYFLATELN
AATEKKCGMEVAISYSSWNDLPNAIFPGGRPAAIGDRARYILSQAHQMNVAQGFAR
Download sequence
Identical sequences A0A090BFG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]