SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090D0W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090D0W7
Domain Number 1 Region: 139-264
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000772
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090D0W7
Sequence length 269
Comment (tr|A0A090D0W7|A0A090D0W7_9BACT) Uncharacterized protein {ECO:0000313|EMBL:CDR33530.1} KW=Complete proteome; Reference proteome OX=1437425 OS=Criblamydia sequanensis CRIB-18. GN=CSEC_0698 OC=Bacteria; Chlamydiae; Parachlamydiales; Criblamydiaceae; Criblamydia.
Sequence
MDSHFKIFFNELSEDRDGGFHKVIALQDEPELDWKSISVLAPTIPKGWFELSKLTKAERL
DLVQQYWEKKMESYPDFCNFLAKFFHEVDDIGIFLTQKTVDHPFEAQMVYSLSKTSCFFR
GLPPLLETQGNQLKDSFKDIIFPQDYLSFLQIHNGFFKTTDKTGLLKAENVIKEYPKFQS
YFSEDEVILTYDKEAINPKKLIPFYISFGMPFYQCFYADWYPEQEMGNVYFSLQDKIVSN
LKGDTAGENLSFPTFIDWVLFYMERIVKG
Download sequence
Identical sequences A0A090D0W7
WP_041017002.1.100884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]