SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090K993 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090K993
Domain Number 1 Region: 4-146
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.97e-26
Family SMI1/KNR4-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A090K993
Sequence length 149
Comment (tr|A0A090K993|A0A090K993_9GAMM) Putative cell wall assembly protein, SMI1 / KNR4 family {ECO:0000313|EMBL:CED60393.1} KW=Complete proteome; Reference proteome OX=80854 OS=Moritella viscosa. GN=MVIS_2451 OC=Moritellaceae; Moritella.
Sequence
MNSIDTFVKNWGSKNAMVPINTQDIAELESKLQGILPDSYKYLISTYGLVHTPNVLTKIC
NLNSDISEVQDFLSLEDVASLSQLYEMGGMPKGHILFASDCKGNMFCFKLSDCANQQTDA
PVWFFNYGACSVTQVSNSFTEWLDEFNEL
Download sequence
Identical sequences A0A090K993
WP_045110625.1.26521 WP_045110625.1.26955 WP_045110625.1.90077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]