SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090KZU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090KZU3
Domain Number 1 Region: 21-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-59
Family Calponin-homology domain, CH-domain 0.00026
Further Details:      
 
Domain Number 2 Region: 2983-3091
Classification Level Classification E-value
Superfamily E set domains 9.55e-26
Family Filamin repeat (rod domain) 0.00037
Further Details:      
 
Domain Number 3 Region: 2920-3009
Classification Level Classification E-value
Superfamily E set domains 1.53e-21
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 4 Region: 2407-2501
Classification Level Classification E-value
Superfamily E set domains 1.53e-18
Family Filamin repeat (rod domain) 0.0061
Further Details:      
 
Domain Number 5 Region: 718-812
Classification Level Classification E-value
Superfamily E set domains 3.8e-18
Family Filamin repeat (rod domain) 0.005
Further Details:      
 
Domain Number 6 Region: 1023-1127
Classification Level Classification E-value
Superfamily E set domains 3.6e-17
Family Filamin repeat (rod domain) 0.0028
Further Details:      
 
Domain Number 7 Region: 1876-1974
Classification Level Classification E-value
Superfamily E set domains 4.8e-17
Family Filamin repeat (rod domain) 0.0035
Further Details:      
 
Domain Number 8 Region: 1700-1792
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000107
Family Filamin repeat (rod domain) 0.0032
Further Details:      
 
Domain Number 9 Region: 2592-2683
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000307
Family Filamin repeat (rod domain) 0.0037
Further Details:      
 
Domain Number 10 Region: 1972-2061
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000327
Family Filamin repeat (rod domain) 0.0039
Further Details:      
 
Domain Number 11 Region: 1789-1875
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000367
Family Filamin repeat (rod domain) 0.0035
Further Details:      
 
Domain Number 12 Region: 636-729
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000867
Family Filamin repeat (rod domain) 0.0026
Further Details:      
 
Domain Number 13 Region: 1584-1664
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000214
Family Filamin repeat (rod domain) 0.0044
Further Details:      
 
Domain Number 14 Region: 2320-2408
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000267
Family Filamin repeat (rod domain) 0.0084
Further Details:      
 
Domain Number 15 Region: 254-342
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000576
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 
Domain Number 16 Region: 537-636
Classification Level Classification E-value
Superfamily E set domains 0.000000000000394
Family Filamin repeat (rod domain) 0.0038
Further Details:      
 
Domain Number 17 Region: 952-1036
Classification Level Classification E-value
Superfamily E set domains 0.000000000000701
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 18 Region: 810-902
Classification Level Classification E-value
Superfamily E set domains 0.0000000000014
Family Filamin repeat (rod domain) 0.0098
Further Details:      
 
Domain Number 19 Region: 2499-2590
Classification Level Classification E-value
Superfamily E set domains 0.000000000133
Family Filamin repeat (rod domain) 0.0043
Further Details:      
 
Domain Number 20 Region: 3482-3533
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.00078
Further Details:      
 
Domain Number 21 Region: 3536-3586
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000103
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 22 Region: 2807-2886
Classification Level Classification E-value
Superfamily E set domains 0.0000000374
Family Filamin repeat (rod domain) 0.0052
Further Details:      
 
Domain Number 23 Region: 2235-2321
Classification Level Classification E-value
Superfamily E set domains 0.0000000494
Family Filamin repeat (rod domain) 0.0076
Further Details:      
 
Domain Number 24 Region: 3586-3630
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000562
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 25 Region: 2117-2191
Classification Level Classification E-value
Superfamily E set domains 0.000000254
Family Filamin repeat (rod domain) 0.015
Further Details:      
 
Domain Number 26 Region: 3634-3666
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000157
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 27 Region: 3879-3939
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000392
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 28 Region: 1525-1574
Classification Level Classification E-value
Superfamily E set domains 0.000004
Family Filamin repeat (rod domain) 0.025
Further Details:      
 
Domain Number 29 Region: 2697-2772
Classification Level Classification E-value
Superfamily E set domains 0.00000934
Family Filamin repeat (rod domain) 0.015
Further Details:      
 
Domain Number 30 Region: 406-476
Classification Level Classification E-value
Superfamily E set domains 0.0000247
Family Filamin repeat (rod domain) 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090KZU3
Sequence length 4151
Comment (tr|A0A090KZU3|A0A090KZU3_STRRB) Jitterbug {ECO:0000313|EMBL:CEF63050.1, ECO:0000313|WBParaSite:SRAE_1000131600} KW=Complete proteome; Reference proteome OX=34506 OS=Strongyloides ratti (Parasitic roundworm). GN=SRAE_1000131600 OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MENYNKIPSDITTVSSDNEEIPEWVVIQMTTFTNWLNYQLRQSNVVVRDLCTDLSDGTLL
IQIVEIFQRRICTGKIYNYKPTEIQCLMNVQMALDALREDGVKLVNIGSQDIVEGNLKLI
LGLIWCLIQKYQISIQSKIPPKKLIMAWLQSVLPEIKLTNFRTNWNTGKALAALINYCQP
GLFEDWRNLDPNNSYENCKKGLELAEKYLNVPSVLNAEHMSSPELDELSTITYLSFFVAE
NGPGYIASLHNCSKLMPDVRITNFDRSWNDGYLFCKLIISVGGEISNFNSMNFNDPNYWI
TNISIALSAASQLGIVSLLGPNDLADPDVEYLGVMALVAALCSLTINDTYEELPTPPPSI
YYQQYFSNEKKNDHNKINIFSETITTSCYQDQQINLDLAFQENSGLTINDLDVIVIGPNN
KVKDHKTLFLVKVKTSKGAVLSFVPDQIGDYQVRILCQGSELPSSPILLTVLPSTDKNFY
QESESNLIEETYQFLPETTNNYNNQIIVEKALFNQEKNNEKEGYSGVSKIMKSHSNIARV
SFSGLSEPCSVGSTVEVVINAHGTDNNTDAIRVTSTSPSGITKDCHVTCDTSSFTATFSP
NEVGEWKIGIFYNYEHIHGSPFSCNVFDPNAVDVYGLDVGLVGQELKFTINTKKAGNGKI
DLDVIRYGKSIPYHLESDNYHEGIYKANFTPDGSGQYKIHIMLNGVEIRGSPYVLDIADA
SSISVYGDNLKMGAVGKGATFMIHAANADTKDITVLITGPSMKSKYGRIIPLGESNFKVE
FKPIEAGEHTIDVQIFGQSIYESPFICNVGDPELVTIEKLPKKIYPSNVGYDITFEIDAT
AAGSGNLEIMINGGRVPCRVKELGPRHFLAEFTIEQLIDHVVEMKFNGVEVTGSPWTLKV
KDIDEERKTFDKNYTTNNLSSSFDGIKSVSNFGMYTNTNNKEIMNDETEYTELSGVGLYK
SAVGQPTHFEISGGNLKAKDVKITLTSPSAIIIPVKVTECDNDKLSCSYITSEVGEHRIN
ILVNGSPLETEPIYVSSFDFTKVKLEAVTGALPEQPVQFIVDAANAGKGQLEISVNRGQV
PNNVKSLGAGRCLITFIPQHPGTYVVDVTFNGHQIHGCPIKVDVQPKQVGKPLPTSIHNS
PLSVLKSTTLNDNSEKLTPIPIITSSTTTTRSTEIERVYDTVHEDNIYDSIKDIKKESNK
SDLFNNYKMSQSDIDNKNDGLKSPKLLRATLDNVKNGKKEIGYTVANYNDDKEDLNENNI
RNKSKLNQDSTNMSYNNDDVYYKGINDNKNVGHEYGIKEKLLHDKSYSKKNEEIILPGLI
VEKKIEELEPNSSQYYYQKRFENIDNEIKEEKFDESLLTTIDKAEESNISTIDPTVVDRP
KVNTKPSIEYDKSTIEKVNEMDVEDFVPKNVPSVVRSTSKGSLYEHKIRKSEDLNEKNTV
KSDYQLEDTLPFDMSLQQEDISEGETKILGKNFDFGKSKFSTKHEVIKKGKDVEVKLESL
KLGKDDTLRITIVPPQRVKGENVQEITPKVKKSGKTYEISFRPTEVGTHKIYAYVNENLH
PLSPFAIRVYDANEINVGDIVSESLVGEVVEFTVDAGRAGFGNLEMAIKDSSNIIIPSHV
SQLETGAAKFLVTFNPTTIGVHTVNITFNKEILKGSPFQIDVVDKKSDDDDSGKKKNLKK
EGLLNVKKNIHDKKKSNEEKVFTTVPKIPSLCRVNKETNFTVNLPFPASELLEVDILDSH
KEKIHAQIYEEKDNVKRVEFIPLRVGDHDISILYGGQEIPNSPFTCRAYDPTKIVVGNIP
NGTIDKAVHFVVDASSAGVGNLEVAVNEGKVPSMAHALGQHKYDISFIPKEEKDHTITIR
FNNEYIPGSPFICHLVAPSYASATGPGLERIQVGNKVHFIINVTGTEVNELPVVKIIDPQ
GLELPCNISNAKDEKNTFIAEYIPNCIGNHRIEVLYDNEPINGSPFISKAFDANKAKLSL
LTDAIINKECNFMIDAGKAGAGNMEIIVSVNEKNVPNFVRAEGQAKFKVSFTPQELKDHY
ISVKFNGIPVPGSPLRCQVKEDTENILSPVSDIPPISRKKEKSTDSTINTVYNNSKITKL
DDNSKLLKEIKVVGDITQGIVGKVKGFSIDGEKKGLECNVVITDPMENIIDVSIEKNDKS
FYVQFLPTHVGIYKIVIIINNQVLPLCPIFMNSIKDDEIIDSNQDNKVSRSNSNNKIDDE
EIIENGIVILKNKVALLGEENEFSIETKDKITKSIIEKNMNIELIDNSGNCLPFKIKGKG
NIITIKWNPLNEGEHTIFAKYKGIHLKNSPSEIIVLDLSAVKIIGLRNGKIYEEQAFEID
WSNSGGRTISVCLTDQNGTVLSCILKKIKNGVHNCIFTPKKIGLYSIDIFIDDVLLPECP
YECTINDQSGLIARGDALTKAQKGKTARFEISLGNCKPGELDVFISDPNNGPVPVKCFKQ
QDEGYWVEFTPEIVGKHVIDVSVGDQKVYGSPFYCKVIDPKEIKIVGFNNKVLINQGIQY
TIRKKDAGEGDVKIEISDPENHSVVFNKVKDYNNDDIITFLPTKLGEYKINLKMNGFQVN
GYPKSIIVERESKPQVFSKGLTHGIDIDEDAHLLFDPKHSQGGIKIHVSGPDNEKIRHVT
KRNDDGTSTISFKPSYPGIYNINIDFNNKPIEGSPFKYYVVDSKNVIIDDENVDSNGVLG
IQLNKQNSINVDGTAAGPGRLTVEVKNKFNEIVDDITTIDSFGEGKYRVNITPRYDDEYK
IYFYWSGNPVPGFYPIIASTVGICKPKQIHTEKIITSSTTYNYSLSSPEVILRGRGAELG
VNGEPNEFMIEFNKPININELSIVLAGDKADIPVKLNYIGNNIYKATYVPKFPGNYTLSI
FSNGNEFFTSQEPIRIQDLKSPADRVLVDFKKLKIGIIDEEMTSLIDTRDAEPGKLSVKC
QGPTSTQDIMLKDNMDGTYFLSFYPKELGKHTLTIKYADQHVPGSPLSFNVSLPPDASKV
KVYGSGIQHGILNNYKSDFIVETKGAGAGQLTVRVRGPKGAFNVEMQRDTKNDRTIHCKY
EPKEPGDYQVEIKWHGKHVPGSPFFVMIVDTEQELQRFLMGEAPSPQPPGPFVPPGWVGG
PLPPINGQIYNSGYPQMIPPPPPHLLHGPPLPIPPHRGIPPQPIIIKLCVRKDQSFAKEI
FFQRVETENADKCLERCLDNVDICRSLVFIKNINSENDLGICQLYTINSETSPIIFKNEN
PSENVTLIYEIAENCNENSYEMSSKLLTRFIGNQQSIGEKSSNSDVTYPQVPIIHISDKK
NIEGPSLPKYPPKIKPIVPVHVSHAQTGLFGFPPLPCTGILCSTPITPTKKTPSPIEAIL
TALNLTTTTQRIEIINNNLPEGTKIYTKSEHFHEEGENIINVDVKKPCEAKKKDDPCVPK
NKEYVMVTKIKEVSENIVYGTWSEWIETGPCSVTTGTGVIIYKRRCLSKEECIGKDTKEE
ICKIESYWSDWSSWSTCSVSCDGGIKSRKRECLGDGDCKGHIDEVLMCNIHKCPQYEEWS
SWSDCSVTCGGNGVRIRNRECKYLGVKSGNCQGPAQDQISCLSDPCPRYLEWQEWQDCSV
SCGQGIQKRIRICYPKGIGCVGGDQEVKFCQKSVCPYLSEWSEFGGCSVTCGIGYCERNR
KCITDGNVDYHSENKSNNKRVKKSNIKLNINNGNISSNLKESEKELLEIDHVRLKREPIR
VKNDSSIFSGCIGSLVERKLCDAGPCCYVGSWTEWTSCHMINNKCLKKRNRPCKPDMSYQ
SQQISHQSSTGLDDGNIKKINEVLTPIKPVNDRRRPNRQIINWDNYHCECNEPLFEDIEC
DENLCEHKSESTELQEALKHRNRPLFLSEVYETPLSNVTTDCTWSSWSEFSTCTSTGSCD
KGAQARTRTCKPVKGFVNLNVCNCPGSNVEAKSCIPEGCIDEKERSIQSKHSISRGSLDS
AIFDYEQEMSGNAKTAIKIVSKPDETDGGNYMTQISFDCNWSTWESWSSCINPGIQTRSR
KCPQNCKCQGIEKEDQKCKVIEDSSQMYETYKIPRSVLQVQPSKYTGANGSGENNSSNDS
YNDNADLIVYARDQKVIKKCEFFPWSEWSDCSNLKNKGERVRMRICGCKDCGKGKSVESE
VCNESINTYKQ
Download sequence
Identical sequences A0A090KZU3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]