SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090L3I3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090L3I3
Domain Number 1 Region: 38-170
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.71e-43
Family Regulator of G-protein signaling, RGS 0.00000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A090L3I3
Sequence length 177
Comment (tr|A0A090L3I3|A0A090L3I3_STRRB) Regulator of G protein signalling domain and Regulator of G protein signalling superfamily domain and Regulator of G-protein signalling, domain 1-containing protein {ECO:0000313|EMBL:CEF64366.1} KW=Complete proteome; Reference proteome OX=34506 OS=Strongyloides ratti (Parasitic roundworm). GN=SRAE_1000262000 OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MLLKLLPCNCSSISESQTLASHKNEGMNQGPTTIDKSTDRMSYDEVQAWGQSFERLMNNK
IGQKYFAEFLKSEFSDENILFYQACEELKREKNHEKIEEKARIIYEDFISILSPKEVSLD
SRVREIINNNMVHPTARTFDEAQAQIFTLMQRDSYPRFIAGPVYKSLISSYGHMEEL
Download sequence
Identical sequences A0A090L3I3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]