SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090L434 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090L434
Domain Number 1 Region: 781-851
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000435
Family I set domains 0.029
Further Details:      
 
Domain Number 2 Region: 461-523
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000759
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 3 Region: 337-394
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 680-738
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 5 Region: 616-676
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 6 Region: 29-75
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000497
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 7 Region: 254-286
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000353
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 8 Region: 1034-1093
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000471
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A090L434
Sequence length 1172
Comment (tr|A0A090L434|A0A090L434_STRRB) Uncharacterized protein {ECO:0000313|EMBL:CEF64487.1, ECO:0000313|WBParaSite:SRAE_1000274100} KW=Complete proteome; Reference proteome OX=34506 OS=Strongyloides ratti (Parasitic roundworm). GN=SRAE_1000274100 OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MSFILRIFFFTYFFFLVRKTFTNSIFSLPFSYGWARWSDFSSCSTECGPGLQYQLRRCLD
IHCSGPHKRYRLCNENNQEKRCRSREKLKEIETCEFINQKDGRYEYIGIDEIENDCEIKC
KSILSGKKVMTNQTKIDGTLCYYGYLKKKGVCIDGACHIVGCDNIINSTAKIDECGRCVT
SGHETPCNKNLTSGIFEWSGSQQFSSCDKSCGPERYRISISICINKKNGKTVPERFCANI
PKPEPIIEKCSYVVCPDKWMKSKWSPCTTSCGDGIQSRNVFCVETHNETLTPNIPPIFRF
KRNNNNDNEYNELEMTNRKVEDKFCWETMKPTNIKSCNYGECPKWKVGDWGVCSVTCGDG
YKSRNVNCFSETKQLDDYYCKNDKPRQIVACYTGLKCINNNITKLSSIILPSKLSLPHED
TQLPWKINKYGYQNDDSSSFSRDNNKDETNENYIHYLTNYEEPHYQAGEWNSCSVTCGSG
IKIRTVECVSSRGLGRGTIKLRDYECEGQKKPDEFENCEEVPCPLKDESVPFTTYNNSSS
IQLLSNNFLTTYRWDYGEWSNCVDGKEKSNLKCIDMIRKVPVSWRYCDPKQRPIDRTRPC
QNIDNIKIDEEEIGEWEILPWGECSSYCGGGFKTRKVRCIKKIENNDIIEEKVILDDNKC
SSIKPSTEEVCGNIDCEAKWKIEPWSDCSTTCGPGEQRRFVVCQQITSQGKLRIFDSFSP
CDSLTKPPTIQLCNYGPCNNILNEDTIFPQHFNQKSVGPSYDAREDHHKKLTLNVGGYAN
LYEGTSLKIKCPVKNFDKSRIIWKKNGKNIINTNHIKVSSNGALRIFHAKMSDAGVYSCI
GNGIQGNVTLAFKHKSEGRKSRGGGHHSSGGGENDNIDSDKQLLQIVRTNLKKTGDNVFY
KKISNLREPGRIKADFIIGNWSSCSLTECSINEEGTQVRAVKCQISYKDLTTYVDDIVCE
QFGVVKVPSSRSCKPEECPFWDSEEWSECSDSRCIHQGTAIQKRNVRCLFANLTIADTKY
CDRSGRPKVKRECVNKKCVAEWKPSEWGSCSKSCGNDGIQMRTLKCVWHGTKKPAGRQCT
NIERPSAVRNCNKNILCPVKKQGEEKTSEPFKGRFFNKYRKMDINNNIVEENKDKKGKCQ
DSSRYCDIFKIFQSCHDNEVREKCCLTCAFHS
Download sequence
Identical sequences A0A090L434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]