SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090LKM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090LKM0
Domain Number 1 Region: 217-421
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.54e-37
Family Reprolysin-like 0.0013
Further Details:      
 
Domain Number 2 Region: 713-762
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.00088
Further Details:      
 
Domain Number 3 Region: 770-817
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000249
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 879-922
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000106
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A090LKM0
Sequence length 1213
Comment (tr|A0A090LKM0|A0A090LKM0_STRRB) Stall {ECO:0000313|EMBL:CEF70374.1, ECO:0000313|WBParaSite:SRAE_2000500700} KW=Complete proteome; Reference proteome OX=34506 OS=Strongyloides ratti (Parasitic roundworm). GN=SRAE_2000500700 OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MTRFAILYIFLCHLLLLISITNSIYQFFTPDELKYTFGVTELSKVPKHDTIYPKNIFKKD
GRLSGIVIKINDEDKYITLEETEDLIHKEIKHIVRNNHNGAGVLSLNNNFEKCHYQHFSN
DMIAAISNCDNEIKGTLIYNDSFYVIHPIPENHHNRVKRSNDGTPLHVIYKRNIPPETDF
CGIDNTITTDDLIEDEAGIHEDVFVIGQQLSQESNLVVEIGVFVDQLLWTHFNNKYGSQA
TSKLQDYTLTMFNNIQIMYKQPTAIPKLNFKIVRFEIFKQQPSALHPNLHQSGNAQLLLD
RFCKYQRNLGVRDWDFAILLTGYDIHRGVNSRSISGIARLDGMCDPWNTCAVSEGMDFTS
AFISTHELGHSLGMRHDEPYCPSKFIMSSSLGPGKVTWSTCSLRDYHSFLQRLDSRGRNC
LRTTNLPERLKIPTDMLPGQLYDANLQCQLMHGPGYHQITPRIDHYDGICFMMWCGQNSF
GRIITSHPALEGTFCGPNKWCQLGRCVPYTGVQRQVGALTTPYPIKTTKPFNTVDGDWSS
WSTAKCSPCTCPNIIGSIGIVKATRTCTNPAPQNGGEECNGSNVIGLVCNRYCGNNNAIS
VNQYITDKCGEHKGNKKDPELTGTGSQLTRFPQRACKVFCDVKTAKGTQKNYRFFGDNLP
DGTSCGWDKYCLDGECLSLSCDNTALINRDVSCPSQKCISPKISGYQYESKNIGGIWSAW
GAWNSCSATCNGGVKQRARSCSVPGKCEGSAQELTSCNTHECPVIRRTEPNWTTWESWNS
CSASCNKGSQARYRRCMSPQNVVSYSCQGESMEIRTCEEIQCPRNRPTKNNVGVWASWQS
WGTCGSNGMQFRYRLCMAEPCDGSGQERMSCIQNNRNDYKWSLWSSWGYCSNNNYKQGTK
SRTRHCQKGNCIGDIRETKPCYEDKTSKQNQATWGGELNEKNNNDSFNNNNNNDNNNKIS
NSIVEGNNEMAPNTTNNGVKDSFESEKIDNSVKQNDDTNNIDKKVVVKSSVPNDTQSINT
ILTSTTIKPFFSLVNPTIYTTLSPTTTTTIQTTTSPTTTITTTTTTTTTTTSPIIKTTTR
IFTTTEGRQSSVSITESTTTLTTTIIPSTLLPSSITTTKNIVSSSKSSILRYHVSIPRNY
IPSSFNIPINPNNINVIIPRRLSTAIRWGYFSQCTIDDSSGCGYGVQKRVRKCYGKGNCR
GKEYESKTCYVKC
Download sequence
Identical sequences A0A090LKM0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]