SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090LMG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090LMG8
Domain Number 1 Region: 237-453
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.87e-37
Family Reprolysin-like 0.0023
Further Details:      
 
Domain Number 2 Region: 1093-1145
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000405
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 3 Region: 977-1026
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 4 Region: 714-745
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 5 Region: 928-975
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000353
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 876-919
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000118
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 1157-1204
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000105
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 8 Region: 1040-1085
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000209
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A090LMG8
Sequence length 1336
Comment (tr|A0A090LMG8|A0A090LMG8_STRRB) Stall {ECO:0000313|EMBL:CEF68715.1, ECO:0000313|WBParaSite:SRAE_2000337000} KW=Complete proteome; Reference proteome OX=34506 OS=Strongyloides ratti (Parasitic roundworm). GN=SRAE_2000337000 OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MKNKFYKFPNLQWGIKWFLSILYLINISYGFHHKLTKRELLHTFGVENYRDTPEYLFINA
EKNIDHVGNKYIKFNAWNDTFLILLKPNYNIIGKDITTVIRDGNKTTQFDFNFNDCHYKG
EVKSHGVNSAISDCSEQLLGTIAMEDHFLILQTIPRRIKNIYNKKHIIFKRSTALIPEQV
IMDIEKKKKMNILNDSPITNKVEEFCDVDSKNLVINYTLPPEAKIDSLFIFPQMDPMTLE
IALFLDSELYKYFKREFALEPEKHLMDFSLALINNVHLLYQQPTLSPNLEIVIVHFELWK
SQPNELETFIHRNGQAQTLLDAFCRYQSRINPGTDLTDSGHWDHGVMLTGYDIYHTTKSV
AGVAPVGRMCDDVFSCSLVEGLHLGRSFVLAHEMGHSFGMVHDGVQNECHKSSYLMSSVN
GAGKTTWSECSSREFTAFLRQLDESGRGNCLRDPAVSISTADHLKDGRLPGQRFTLDQQC
SYFWGTDYQVEIPNGRKLEDICRILWCGNNGSTISTAHPALEGSWCGDRKWCNHGKCKRW
NFDGDEPKVINGEWSSWFSKESSCPITPCQITGSISVRSQIRTCNNPAPNNGGRGCQGNN
IRGIICGSPHCNGFNQQQYGDKLCSALKNDKTKPDRQLSGKSFLHHQQPCKVWCHLKDSE
LIRNKGQFPNGSPCGDGKYCVGGSCLKVSCNSTMLTNDEEDCEKNLSDKIDTSKVWGQWS
SWSNCSVDCGTSGVQKRTRECVVSLKNNINKKKILKPKIDAKRQATNFLNIFKPQLPKKN
PKKVAPKKGKKNKNNKGKKGGKPKNPILLNEDLNCFGNSLEIRPCDPKPPPCIILGTWEE
WSSCNNGEQVRRRICLSGDNCIEEEMVEKKKCDTVKEWSSWLPCSVSCGIGFQVRERLCN
GVTCKDSQKQAKTCNIQNCISIEKEKYQLGEWSEFSECSMTCGEGLKTRIRSCIKGVCPI
SLKYTETVTCNVGDCDNKWSEWKEWGECDAICGEGKQKRFRTCKADFVFLCSGDSFEEKP
CFGEPCIMRSSITLQHTNLPTWSEWSSYSECSCFSQTQYKRRYCQISDPSLQGFCIGPIT
DTRSCQPINCRPINGGWSEWSEFSECSKKCGTAIGHQIRNRMCSSPLPANKGAYCSGYSF
DQRPCRGDIEKCTEPPVDGGWSEWTEFGECIDCKYTSRTRYCNNPIPKNNGKSCKGKDFE
MKECSCNDDSNINVEGSGNINHWGEWSEWNNNNTCLTERFRVCFGSCTGEAYEKKDKCYN
EIDKYNEWSEWSNCQITNCSTLSSTRTRSRSCVTSCKEHYKIEEESCNQKFQVKGIKKFY
KLKSCSSFVKNLIANF
Download sequence
Identical sequences A0A090LMG8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]