SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090MC98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090MC98
Domain Number 1 Region: 654-723
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-24
Family Kringle modules 0.0007
Further Details:      
 
Domain Number 2 Region: 1717-1773
Classification Level Classification E-value
Superfamily EF-hand 0.000000706
Family Calmodulin-like 0.05
Further Details:      
 
Domain Number 3 Region: 1438-1486
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000144
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A090MC98
Sequence length 3762
Comment (tr|A0A090MC98|A0A090MC98_OSTTA) Kringle, conserved site {ECO:0000313|EMBL:CEF99734.1} KW=Complete proteome; Reference proteome OX=70448 OS=Ostreococcus tauri. GN=OT_ostta11g03050 OC=Mamiellales; Bathycoccaceae; Ostreococcus.
Sequence
MVTLFRLATLLSLCVLPFAETAVGESRAPESFATETPVETAAAVSAIRVDKDGILWREIS
KARHLENSRDDSIWGSTKVYRANDANGSPMFEVVYPEVNITLNQSSAQKIPTKEEEHRYL
SEHYVEFQKSSQSLHAERSGELSPSLGMNETDGNATAELGGSCGYPTSYCRVSYLSNCPS
RYACWQGDRPKYRTYDCHGRIESFQHRFTTRHCCGRNIWGSCTRHCTKWHSITLFKWNSC
SYKAWSSYHHTCPNDVGRCPLIFDVKINNPVKDVASNAVDFGFEVIQQQLCGGNCLTSTR
GTRRMVRISVTVRKVGHACSSYGDHLPCKRWDNFHDPYFGGKLLGLTNSQGSVDVGQYEI
AYNVLHGLPGQVTHEGVTGKHTFSTTRGCDGIMPSSSIGHQTVENSELIKFILLSTDKFV
NTPCEKISEVKESIFREIDVNVTDGVLTYDEIARAVRKNGGDSYVLKVWNHTRELRVSIG
QFMKTSVIPHACASAYRAGQQVTFSSTVYPSIDPGRMTTNKQCADDAKKMSLAWKYSATV
PKQGDIVCVFVDGLLFNRNEPSLSKPTVNADDYAQGSNNLWMLTKMTDRRPVIGGMKETL
PSLVAQFTFDSSLFYGDTVGKTRVDSAAPLADGQTFRPSLQSKVGRDEELKGFRDRDYRG
AQSKTRSGRTCQNWDTQSPHKHTNKRSSDAGTVSNNYCRNPDDGSTIWCYTTDPATRWEY
CDPVPIVPQPVPVPKACSGASGGKCFQPGSTLVYKGEPFQDSVAFSTWVRCSKGKYTTIV
EFSGKDGRGSQSLSLSLDATCGLKIEHRRSGEPPKHIALQVSPSTWTLVGFTLSHTNGMT
LFALPIDSTSVVRINDAQWPKDTLTKMPDIDLLAGQSTSEFDDIRFYTGIMDLSIFTDSR
ECGRARYCADRAHATPSHRRVVCVTANIKGLETQEPVCTSALYYDGTAIDIQASMDMAGV
VFAFRDTNWQESSFEIERRSPSLDGASSFDTVVLVEGDLKGCAAKFSSITYMDRDASYTP
YKEWLYRITTKNPSNAASPFLVSSQILFRTPWKSLLEGRVLAGASTTGVRNVRLCAEFDT
FISHQRQSDTFVDRNTTTINLAAYKSTKHSNGEKTSTAYVATDGLEDGEVVGMDIDEYIR
VNLGTWSSVSTVAVCYKNTSSKLPMFTTYVQDHDPEDSSVYGHECLMTHARASFDNPKEY
ACLSYSCRGTGVNSFHGQHITVVSLNRTEVSEIQANGLNTKCKFTAMTGDDGEFEMQLED
TSGKVPVKARLHVGAYKEEIFPETTETLIDTKKDAHGNYTVPRSQAHEVLLILRERSVSS
QDDSPTEGNSSDAAFLGDWDYSDVDFEDGNDESSFIGEKPVHGRSLLGSLRRDCSYSWGS
WSTCTKHHYSSGRWTGIRYRTFYIWRYPDPYGFGTRCPSGYTNRRRYSGSCTPDVDCQGS
WSGWSTCSRSCGWGQQTRVYRITTNAQGGGSRCPTNNGYRQSQSCLVKQCPPPPSPPPPS
PPPEAAILSEKIEWTLLDGLSSSAQGEVTRDRSGSGWNAGAVSKRAIKSGSDVVRGISAV
IGDSMMNAMIALNSQSTAKSTDYQSLDFALYADSAGYLIVYEKGTQKEQLEKYEAGDTIQ
VVLNDDGQVEYFKNRLKLRTSTQTVEYPLHADVSIHNTGKTFKDVHWMERISSPPPSPPP
PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPNHELEQADTDNSGNLTRTELIAFIEKITI
SSRGNAIIDDDVWKVLDVDEDGFIDAAEFQVIADRMVAQTLVVEPMIVFPMQDLKHMYNF
TLVQTSDDVENNITSGATDVSAATQSCENLVLRRSSSGSLPFTNEGWTAFYYNFIKDRQS
NFTCRPLNANEVPVIEVGSEDGQYGIPVLANKVSMNYLVLDAHTTAKRKLHADLDIFHRL
TRAQLHVRVKAKKRLPDIIHRFNKPAMPRQARESQESSDDMVLYGIFSDEAILDRVTVEV
KHKRVEEKDFTDDTMAIVNGAILFPKDLVEQSTDCGLSKATIQVFEPEGEIEEYLTDERG
FFKIAVTRGKTFTFRAKYKGHSICYAGNTLESALEDVHTCAGRHNYTKLENVNDGNFIFF
SDTTRGSIDLGLYHGECSERYGGATFKITPINGCHASTFVTSEQIAGWSVGSDGDPDAKV
WPFAAMDYSVTLTSGPDINAVQQLIADEDWKDSCGTEPGNIVSFFRSRNALERVVPMRDE
FAELVSIRYKYHGFICIEILNIPKIRNPLEVCYDPNEDEGNITKKHFLGKTTSEDLGSIE
EATPIEAKIFELHVDEVGGKSVLSKCFKALPNMKANTGSTMVKFRQSITDEDSNECHPNR
GGGPMCDFDATIDPESELLIWNEQGNTNVMVRAGKPYLGGNHRRAVEITVNRYDTYKSVT
AYAKRELIPLGTRPRFFGGLSDDTYWATVPIEGLVYTVVHDPPGGNSYAELTTGSQIGLE
FDIANSREASEEKSSEIEDDFPELDESMNVGFNAGWVAEGALDYKLNLIKSSGQVKSGGG
PKMSMSSSERKGWSVETTTDRVIRSSQDVATPGRDGDVILGGGIELVYKMSDVLDVVNDV
RTLKKPCLYVYAQITWQPRRPTSYVMTVYAIENQVVPNLHYLISVVREGGVAGDGSKMLY
DCGDSGKTSKTDCTKDEQVAAWDKYLTGKIDVWRRTLEWSSPKVFTLNKGGEYTKAYDAI
EAITAPMTEGFLGDLYKRQVQYFEDEFLKPMKDIVEDVASVWDSTHYMQPFNGLGPPPNF
PDLKLGFGGDWMFDSRFWESDDDDVSIYERLTQQNTMTYSEKQATRSVAAGGARAAKVIL
AAKAAREKAVEAAKEKQKKVMQKWQQKQQKTSAATLKKLEDLKDAKKKAKKAARKAAAIK
IALLSIQGVIAAAGGALDKSGYKYVVYPRKFYKEGIPYFEENFFDDDYNVLQGGDQIKDE
DGMRQEYTWGLLETATNDMLRSFQSCGGRECKPNELSTDKLSPSESLTIFGEDDKLLTDK
YEPTAMQRVVASFTGALAPSGMKETSKKEGNEAILLSFSGGGHSVDYAFKSEEKIADIGV
SLGVGFSGEVSNDYKLELGGLIGMIMEITMMAAGIDTEAEMTFSKDLSQDRSFAWNRHAS
LTTMYSLGDPEYGDKFVVQVGEDKRFGTPVFITKGGRSMCPGEPLTIFREAGWSLSLATT
WNENLNPSEKAILRLSVINASPYKEKPNLGLRIIDGLSQSVHTVVAAAYEAAAQDGATGT
HVLSAVDDAISKLTIGKTTAVIQRMKRDAREAVEVHKASAVSTAAVIIQASKDAPRMYEE
IQDMQLTVGGKPFTPGEVIPVTFVDGESLSVQKRQLETAFTLHILPTSSAVRRLDHIALQ
LVSLCEQELSENNNFARDPVGASIWLREMSWSQECPKVAFDGTTMANYRFSSVSPNEPDP
LELTVFNPSGSLLWPGSRDGDPSVNPNLRFVRLQYRPVSGGEWITAKSEDSDPKFSYKKN
LLCAGSRLAGCSFKWDVHNKYELLLSGFKDGVYELRVKNFCFGTPAAPISALADSTVHEY
ISDEILTLRVDTKRPIYVRAQSTFGSSYVVEFAEAIDCSDQKVKITKKRTACGSAGASVN
EVVSEEAIKTDFTFQCATDGSGSSKWMIDFPSNHVGEYEVSVHGVRDVAGNAAKPFNFVM
NSHCTSTPSQVSLNESLLGTDKTSLKIHDEAHTSTLTARLGSREAVLNHLSVELLFTFFA
VVALVAFALRSGHARKIQKVLDKTADDACIQPEDRQSYGSTV
Download sequence
Identical sequences A0A090MC98

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]