SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090PPK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090PPK4
Domain Number 1 Region: 2-115
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000929
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A090PPK4
Sequence length 126
Comment (tr|A0A090PPK4|A0A090PPK4_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:GAK91348.1} KW=Complete proteome OX=906888 OS=Nonlabens ulvanivorans. GN=JCM19297_845 OC=Flavobacteriaceae; Nonlabens.
Sequence
MLPDDYKLFLKMSNGFKATTHVDITFESTDRVDYLSNFENYNGSLTFYDDMDGYEEISLQ
FKKSILIGGIEEEQIFLLLPPVGNMEKWRYWQFANWIPGEEEYENLEAHFIDVLDLLEEL
IEEKDI
Download sequence
Identical sequences A0A090PPK4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]