SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090PV72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090PV72
Domain Number 1 Region: 23-164
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000144
Family SMI1/KNR4-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090PV72
Sequence length 174
Comment (tr|A0A090PV72|A0A090PV72_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:GAK94665.1} KW=Complete proteome OX=906888 OS=Nonlabens ulvanivorans. GN=JCM19298_240 OC=Flavobacteriaceae; Nonlabens.
Sequence
MLLEQISIKAIELGGESDFSEKQIIESWLGREPATQSDINHLEKRLGVVLPDDYKLFLKM
SNGFKATTHVDITFESTDRVDYLSNFENYNGSLSFYDDMDGYEEISLQFKKSILIGGIEE
EQIFLLLPPVGNIEKWRYWQFANWIPGEEEYENIEAHFIDVLDLLEELIEEKDI
Download sequence
Identical sequences A0A090PV72

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]