SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090RL13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090RL13
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily VC0467-like 4.19e-66
Family VC0467-like 0.000000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090RL13
Sequence length 187
Comment (tr|A0A090RL13|A0A090RL13_9GAMM) UPF0301 protein ABT58_20020 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome; Reference proteome OX=754436 OS=Photobacterium aphoticum. GN=ABT58_20020 OC=Vibrionaceae; Photobacterium.
Sequence
MNLTNHFLVAMPSMQDPNFKGGVVYICEHNDEGAMGIVINLPIEISVGSMLDQIDIERDA
PVTDPASLEQPVFNGGPVSADRGFVLHNLSGRFSSSIAITEEVSVTTSKDILALLGTDHA
PEHFLVALGYAGWDAGQLEQELSENTWLTTEADPDVVFNTPVNERWTKAIAQLGINATHL
SIEVGHA
Download sequence
Identical sequences A0A090RL13
WP_047876211.1.52380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]