SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090SQH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090SQH4
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily Heme oxygenase-like 3.56e-17
Family TENA/THI-4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A090SQH4
Sequence length 81
Comment (tr|A0A090SQH4|A0A090SQH4_9VIBR) Thiaminase II {ECO:0000313|EMBL:GAL21637.1} KW=Complete proteome OX=990268 OS=Vibrio maritimus. GN=JCM19235_1459 OC=Vibrionaceae; Vibrio.
Sequence
MIGKALIESPTTVLEDNPYRSWIELYAGEDFQSGVQVSIERLDTLLKDIELDSPRGQELI
HVFKTATRMEIAFWQQGLDTK
Download sequence
Identical sequences A0A090SQH4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]