SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090VK09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090VK09
Domain Number 1 Region: 92-222
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.77e-40
Family PH0987 C-terminal domain-like 0.0000333
Further Details:      
 
Domain Number 2 Region: 7-97
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.000000000000706
Family PH0987 N-terminal domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090VK09
Sequence length 243
Comment (tr|A0A090VK09|A0A090VK09_9FLAO) Allophanate hydrolase 2 subunit 1 {ECO:0000313|EMBL:GAL63689.1} KW=Complete proteome; Reference proteome OX=221126 OS=Algibacter lectus. GN=JCM19300_2725 OC=Flavobacteriaceae; Algibacter.
Sequence
MAFKLCYKSLGLHAVLVEWPAEIREDVLQDVLILKTKIENYHVKEIIQVNSSYNSLLVFY
ENTNISLEERIAIIDKIYSSKNNAIYVASQLWKIPVCYDEAFGLDLDAVSIEKKVSKNDI
IKQHCGVIYTVYFIGFLPGFLYLGGLDKLLQMPRKSTPRLQVAKGAVAIGGNQTGIYPNE
SPGGWNIIGNSPLNFFDVSKEKPCFAKAGDRVQFYSVSLKTYNNIKTLVEAGVYQLESEE
VND
Download sequence
Identical sequences A0A090VK09
WP_042505508.1.62835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]