SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090WED8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090WED8
Domain Number 1 Region: 25-165
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000127
Family SMI1/KNR4-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A090WED8
Sequence length 176
Comment (tr|A0A090WED8|A0A090WED8_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:GAL75380.1} KW=Complete proteome OX=906888 OS=Nonlabens ulvanivorans. GN=JCM19275_1831 OC=Flavobacteriaceae; Nonlabens.
Sequence
MKKLLEQISIKAIELGGESDFSEKQIIESWLGRESATQSDINHLEKRLGVVLPDDYKLFL
KMSNGFKATTHVDITFVPTDRVDYLSNFENYNGSLSFYDDMDGYQEISLQFKKSILIGGI
EEEQIFLLLPPVGNMEKWRYWQFANWIPGEEEYENLEAHFIDVLDLLEELIEEKDI
Download sequence
Identical sequences A0A090WED8
WP_042296149.1.21841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]