SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090X1F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090X1F7
Domain Number 1 Region: 28-95
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000706
Family SMI1/KNR4-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090X1F7
Sequence length 118
Comment (tr|A0A090X1F7|A0A090X1F7_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:GAL82603.1} KW=Complete proteome OX=221126 OS=Algibacter lectus. GN=JCM19274_5678 OC=Flavobacteriaceae; Algibacter.
Sequence
MNEYPDSFFIRNEEIISTYQDVLNNEDELWFDLEPGIIYDQLKNLIPFAMSENGHYLFWD
IENGENDEFDIYITDFRGLGFTKIANNLYEFFDKITSQLEFKKILLLVKNHCQELLKH
Download sequence
Identical sequences A0A090X1F7
WP_052416569.1.40616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]