SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090XCU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090XCU2
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 9.16e-39
Family Fibrinogen C-terminal domain-like 0.0000906
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A090XCU2
Sequence length 198
Comment (tr|A0A090XCU2|A0A090XCU2_IXORI) Putative ixoderin b6 {ECO:0000313|EMBL:JAC93205.1} OX=34613 OS=Ixodes ricinus (Common tick). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
DGGGWTVIQRRSEKEEGDEVFFERNSTEYERGFGTAGESFWIGLTNLNALTSYPNNQQAL
RIELKISSGRHREEVVQYGEFHVGSAKEYKLTIEEYDHNKSTSYNALSHHKGAKFTIRNN
SKAADKDCRAGALSGGWWFTTCNEANLNGRKSNFSTLQKPGIIWKEISRMDYYEYTYDKV
EMQIRDADFGFCTGSLKS
Download sequence
Identical sequences A0A090XCU2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]