SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090YA20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090YA20
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000288
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090YA20
Sequence length 190
Comment (tr|A0A090YA20|A0A090YA20_BACMY) SMI1-KNR4 cell-wall family protein {ECO:0000313|EMBL:KFM95588.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=DJ93_5507 OC=Bacillus cereus group.
Sequence
MKIKLPNVYKDLLKYTNGFSIGGGLTIYGTEDIIERNETWEVTEYANGYVSMGDDGSGNV
FLMLQGADAKEVLVVDSGDMDSNHATVITLDFSEWVNTGCLNEKIQKIEVEFPDTCNIVL
VETPNGGLKDLVKIKSVLAIDISTGDLLKGSKNLPFTLVKKFPYGKTKKLIEKLGPVGVV
LNAVPIDINN
Download sequence
Identical sequences A0A090YA20

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]