SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090YJM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090YJM3
Domain Number 1 Region: 57-168
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000392
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A090YJM3
Sequence length 169
Comment (tr|A0A090YJM3|A0A090YJM3_BACMY) Syd family protein {ECO:0000313|EMBL:KFM99013.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=DJ93_4542 OC=Bacillus cereus group.
Sequence
MKICFDKIVREWQQCNDSLPKSLWIEEADTFIYEGKPDAEGYVCWRPLEKHVIHDFSHIE
KDWGIQLHNSIQEYYNSYWFLDLGGNYLGYDFELNPVIPGIELHDFYVSLQGYKSAHDNQ
LNNIPIGMEFNGFLVVVDNENGKVKLEDYEGGSFKVICDSLAELILNLS
Download sequence
Identical sequences A0A090YJM3
WP_042983408.1.75915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]