SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090YVM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090YVM5
Domain Number 1 Region: 13-133
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000746
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090YVM5
Sequence length 142
Comment (tr|A0A090YVM5|A0A090YVM5_BACMY) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KFN02460.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=DJ93_4773 OC=Bacillus cereus group.
Sequence
MNILEKLNEAFTLEAQESPASKEAIQELQKFSSIDVPLDYLEVIQHSTNAEINVQNELYI
RIWSPTDCIEMNEAHDIQKYIPNSLAIGDDEGGKALLYVDGKEGFGLYTVDFGDLDIEEI
IKIAPSLKALLIDGVGVEELLS
Download sequence
Identical sequences A0A090YVM5
WP_042983608.1.75915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]