SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090YW33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090YW33
Domain Number 1 Region: 15-112
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000706
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090YW33
Sequence length 119
Comment (tr|A0A090YW33|A0A090YW33_BACMY) Uncharacterized protein {ECO:0000313|EMBL:KFN02173.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=DJ93_4615 OC=Bacillus cereus group.
Sequence
MEKFYVDKDIYIYPESYQKLIELNLVDFDVWYLIESGQATRRYHDLKERYPRRSLIPFAR
RDDNDDIACFEIGKGNKVQLIHDFTSEGFEQRKEFGDFWEWVEFAMKEMIDYNRSEEIE
Download sequence
Identical sequences A0A090YW33 J8RB42 R8EDB5 R8HKP5
WP_000410660.1.11609 WP_000410660.1.21695 WP_000410660.1.2902 WP_000410660.1.6 WP_000410660.1.75915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]