SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091AQC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091AQC4
Domain Number 1 Region: 23-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000732
Family SMI1/KNR4-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091AQC4
Sequence length 152
Comment (tr|A0A091AQC4|A0A091AQC4_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KFN41342.1} KW=Complete proteome; Reference proteome OX=1121015 OS=Arenimonas oryziterrae DSM 21050 = YC6267. GN=N789_05565 OC=Xanthomonadaceae; Arenimonas.
Sequence
MTDSQVIEITEHLQILGFPLEHAVDCPWLAKLEASFGRRLPEPYRSLLEFYRFRAFDVPG
FESFSNLGDGSDEDITVAPFKDPAVRDWLIPRGFLQIGRPDTGSYDPVCLDMRTRPDAPA
IVRFDHEDILLNRSRIEPIVVAESFSALVLAG
Download sequence
Identical sequences A0A091AQC4
WP_022968041.1.46590 WP_022968041.1.49221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]