SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091AZ68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091AZ68
Domain Number 1 Region: 6-187
Classification Level Classification E-value
Superfamily VC0467-like 7.72e-64
Family VC0467-like 0.00000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091AZ68
Sequence length 187
Comment (tr|A0A091AZ68|A0A091AZ68_9GAMM) UPF0301 protein N787_12595 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome; Reference proteome OX=1384056 OS=Arenimonas metalli CF5-1. GN=N787_12595 OC=Xanthomonadaceae; Arenimonas.
Sequence
MQTPPSLADHFLVAMPALEDPNFQRSVTLVCQHDAGGAMGIVINRLADYTVGELLDHLRL
GTQNPALAGRAIVAGGPVHPERGFVLHGDDSEWNSTLHVAPGLSVTTSRDILEALSRGDG
PARVLVALGYAGWEPGQLEDELAQNSWLTVPVDRGIVFDTPLEDRWRAAARQLGVDLSTL
TDYSGHA
Download sequence
Identical sequences A0A091AZ68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]