SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091BHZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091BHZ4
Domain Number 1 Region: 35-166
Classification Level Classification E-value
Superfamily Sortase 1.12e-18
Family Sortase 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091BHZ4
Sequence length 172
Comment (tr|A0A091BHZ4|A0A091BHZ4_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KFN51376.1} KW=Complete proteome; Reference proteome OX=1121013 OS=Arenimonas composti TR7-09 = DSM 18010. GN=P873_03665 OC=Xanthomonadaceae; Arenimonas.
Sequence
MLALHAGWMPAKAALAQHLLGEAWEQARGDGGAHRPWPWADTHPVARLSAPRLGRSQIVL
AGDAGRPLAFGPGWAEASAAPGTTGTTVISGHRDSHFEWLRELQHGDVVELEAASGISRW
TVAGSEVVDSRTTRLDVTAAADRLVLVTCWPFDAVAAGGPMRYVVTLEPQPE
Download sequence
Identical sequences A0A091BHZ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]