SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091CL85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091CL85
Domain Number 1 Region: 70-206
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.79e-38
Family Regulator of G-protein signaling, RGS 0.00000554
Further Details:      
 
Domain Number 2 Region: 754-834
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.54e-27
Family DIX domain 0.0000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091CL85
Sequence length 834
Comment (tr|A0A091CL85|A0A091CL85_FUKDA) Axin-2 {ECO:0000313|EMBL:KFO18098.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_20550 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MSSAVLVTRLPDPSSSFREDAPRPPVPGEEGETPPCQSGVGKGQATKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKNQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNSGLGSLKVLCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATVGVRSMETVENGYRSFKRSDPVNPYHVGSGYAFAPATSANDS
EVSSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMAPVEPAAFAAELISRLEKLKLEMESRHSLEERLQQIQEDEEKEGSEQALTSRDGAPVQ
PPLSLLPSSSYEEDPQTILDDHLSRVLKTPGCQSPGVGCYSPRSRSPDHCHQQYHSLPPG
GKLSPTATCPLLRVKGFLTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVRCFCPGSTE
YYCYSKCKSHPRALEPVPGEPFGGSRGSALPKRNGKGTDPSLALPTREGGAPSGAGALQL
PGEEGDRSQDVWQWMLESERQSKPKPHSAQSTKKVYPLESARASPGEQVSRHHLWGGSGH
SRTAPRAHPFAQDPAMPLLTPPNTLAQLEEACRRLAEVSKPSKQRCCVTSQQRDRNHTAT
GQAGATLFSTPGLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLG
HFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPMYEGRILGKVERID
Download sequence
Identical sequences A0A091CL85
XP_010615110.1.5607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]