SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091CT53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091CT53
Domain Number 1 Region: 67-277
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.54e-53
Family Reprolysin-like 0.00086
Further Details:      
 
Domain Number 2 Region: 370-424
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000994
Family TSP-1 type 1 repeat 0.00052
Further Details:      
 
Domain Number 3 Region: 680-733
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000123
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091CT53
Sequence length 733
Comment (tr|A0A091CT53|A0A091CT53_FUKDA) A disintegrin and metalloproteinase with thrombospondin motifs 5 {ECO:0000313|EMBL:KFO21567.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_16997 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MKVNIEEERKERGKKKDKATDDQEAEGLNLRIKKQQLSTIATSSKILRPAGEPGPQTWWR
RRRRSVSRARQVELLLVADASMAKMYGRGLQHYLLTLASIANRLYSHASIENHIRLAVVK
VVVLGDKDKSLEVSKNAATTLRNFCKWQHQHNQLEDNHDEHYDAAILFTREDLCGHHSCD
TLGMADVGTICSLERSCAVIEDDGLHAAFTVAHEIGHLLGLSHDDSKFCEENFGSTEDKR
LMSSILTSIDASKPWSKCTSATVTEFLDDGHGNCLLDVPRKQILGPEELPGQTYDATQQC
NLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTPCGKGRICLQGKCVDKT
KKKYYSTSSHGNWGSWGPWGQCSRSCGGGVQFAYRHCNNPAPRNNGRYCTGKRAIYRSCN
VLPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVLPGDVCKLTCRAKGTGYY
VVFSPKVTDGTECRPYSNSVCVRGRCVRTGCDGIIGSKLQYDKCGVCGGDNSSCTKVIGT
FNKKSKGYTDVVRIPEGATHIKVRQFKVKDQTRFTAYLALKKKNGEYLINGKYMISTTET
IIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDPTKALDVRYSFFVPKKSIP
AVNSVTSHSSNKVGMHTSQLQWVTGPWLACSRTCDTGWHTRMVQCQDGNRKLAKGCLLSQ
RPSAFKQCLLKKC
Download sequence
Identical sequences A0A091CT53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]