SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091CU94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091CU94
Domain Number 1 Region: 59-167
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-31
Family C-type lectin domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091CU94
Sequence length 179
Comment (tr|A0A091CU94|A0A091CU94_FUKDA) C-type lectin domain family 4 member A {ECO:0000313|EMBL:KFO22047.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_16551 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MLLVPLLLFILLSVVFTVAFIIFFQKYSQLLKEKTTVKESTQKHTELECKRSNSTKEAKA
KSWQESKEHCSSLEAHLVVITSKEEQHFITQHMKTNAAYYVGLSDPHGQRHWQWVDQTPY
NESATFWHDDEPSSNNEHCVILNYRGKWGWNDASCDGPQESVCEMTSICLVDTHRYTAS
Download sequence
Identical sequences A0A091CU94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]